genome annnotation by maker

classic Classic list List threaded Threaded
1 message Options
Reply | Threaded
Open this post in threaded view
|

genome annnotation by maker

djerroud samia
Hello,

 I am trying to do the structural annotation of procaryotic genomes and metagenomes. I want to get the positions with the sequence of cds and the gaps. Something like that:

 gene            478..1299
                     /locus_tag="DU99_RS00005"
                     /old_locus_tag="DU99_00005"
     CDS             478..1299
                     /locus_tag="DU99_RS00005"
                     /old_locus_tag="DU99_00005"
                     /function="miscellaneous; hypothetical/global homology"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_384107.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoenolpyruvate synthase regulatory protein"
                     /protein_id="WP_010968285.1"
                     /translation="MENRKNYFHLHLISDSTGETLIAAGRAAAAQFQSSHALEHVYPL
                     IRNRKQLMQVMDAVDGAPGIVLYTIVDRELAGLIDQRCREIGVPCVSVLDPIIELFQS
                     YLGSPSRRRSGAQHVMDAEYFARIEALNFTMDHDDGQVPSDFNEADVVLVGVSRTSKT
                     PTSIYLANRGIKTANIPIVPGVPLPDALLKATKPLIVGLIASAERLSQVRQHRVLGTT
                     QSFHGEDYTDRAAIAEELKYARSLCARNNWPLIDVTRRSIEETAAAIVALRPRLR"


Do you think that maker can help me to do that ?? IF so what is the part of maker that can do that ?? I will really appreciate if you help me :)

Thank you,
Samia

_______________________________________________
maker-devel mailing list
[hidden email]
http://box290.bluehost.com/mailman/listinfo/maker-devel_yandell-lab.org